Bienes con certificado en trámite

Listado de bienes para la verificación de ausencia de producción nacional.

Producto Descripción Cantidad Rubro Moneda Valor FOB Valor CIF Inicio publicación PDF
D055-3-Anti-M6a (Mouse) mAb El reactivo consiste en un anticuerpo monoclonal comercial (D055-3) hecho en rata para la detección de GPM6A. El anticuerpo permite el reconocimiento de GPM6A en ensayos de Western blot (nativo), citometría de flujo, inmunohistoquimica, inmunocitoquímica y para inhibir la función de GPM6A en cultivo de células. Los usos que se le darán a este anticuerpo son claves para el desarrollo del proyecto presentado ya que es el marcador por excelencia de GPM6A. 3 Anticuerpos Dólar 918,99 23-09-2021
KQIINMWQEVGKAMYAPPISGQIRRIQRGPGRAFV-TIGK 5 mg El material a importar consiste en el péptido sintético PCLUS3.Se utilizará para dos aplicaciones claves para el proyecto: se inmunizará a los animales con el péptido en conjunto con inhibidores de proteasas. Luego, las células inmunes de los ratones inoculados serán evaluadas in vitro para determinar la inmunidad T específica frente al péptido. Los usos que se le darán a este compuesto son claves para el desarrollo del proyecto presentado. Los compuestos se usarán exclusivamente para investigación 1 De laboratorio Dólar 1500,00 23-09-2021
Cromatógrafo iónico para análisis de aniones en solución Ion Chromatography System 1 De laboratorio Dólar 16967 23-09-2021
Desorbedor Termico Manual Art.: U-UNITY-E-XR 1 De laboratorio Dólar 33.804,00 23-09-2021
Accesorio neumático de Regulación dual ( para el gas seco y gas de carrier ) Art.: U-GAS01 1 De laboratorio Dólar 1.485,00 23-09-2021
Plataforma de carga de solución de calibración Art.: C-CSLR 1 De laboratorio Dólar 500,00 23-09-2021
Trampa de enfoque para análisis de tóxicos en aire, para Unity-xr (y serie2), TD-100 (todas las series) y Centri. Art.: U-T15ATA-2S 1 De laboratorio Dólar 522,00 23-09-2021
Trampa fría para emisiones de materiales C4 a C32 Art.: U-T12ME-2S 1 De laboratorio Dólar 522,00 23-09-2021
Tubo de acero inoxidable, Universal, acondicionados y tapados (Pack x 10) Art.: C-3AAXX-5266 1 De laboratorio Dólar 944,00 23-09-2021
Tubo de vidrio, vacío, (Pack x 10) Art.: C0-BXXX-0000 1 De laboratorio Dólar 423,00 23-09-2021
uranio Enriched Uranium Metal 60 De laboratorio Dólar 677.600 23-09-2021
8305-001 Aceleròmetro patròn de ref, con cable y calibraciòn primaria a 160 HZ 1 De laboratorio Dólar 8641 9101 23-09-2021
BTC-6HD-MXP Dark Ops HD MAX Plus Càmaras trampa 10 De laboratorio Dólar 974,90 23-09-2021
Browning Trail Cameras 32GB SD card Cámaras de seguimiento. 10 De laboratorio Dólar 135 23-09-2021
FREEZER PARA ULTRA BAJAS TEMPERATURAS -86ºC. MODELO COMERCIAL: MO528S FREEZER PARA ULTRA BAJAS TEMPERATURAS -86ºC. MODELO COMERCIAL: MO528S 1 De laboratorio Dólar 9000 23-09-2021
FREEZER PARA ULTRA BAJAS TEMPERATURAS -86ºC. MODELO COMERCIAL: MO528S FREEZER PARA ULTRA BAJAS TEMPERATURAS -86ºC. MODELO COMERCIAL: MO528S 1 De laboratorio Dólar 10000 23-09-2021
A1x32-Poly3-10mm-25s-177-OA32LP Los optoelectrodos NeuroNexus permiten la estimulación optogenética simultánea y la electrofisiología de alta resolución. 2 De laboratorio Dólar 2490 23-09-2021
A1x32-Poly3-10mm-25s-177-OA32LP Optoelectrode for research Optoelectrodo para investigaciìon cientìfica 2 De laboratorio Dólar 2490 23-09-2021
Acute Smartlink32 headstage Los cabezales SmartLink conectan electrodos convencionales de alta impedancia (como los electrodos estándar NeuroNexus) al sistema de amplificador SmartBox 2 De laboratorio Dólar 2730 23-09-2021
SmartLink Cable Cable Smartlink 1 De laboratorio Dólar 380 23-09-2021
CKTB40/9/40:GL Capacitador variable de potencia CKTB40/9/40:GL VVC VACUUM VARIABLE CAP 1 Repuestos y accesorios Dólar 558,00 768,00 23-09-2021
CENTRÍFUGAS DE MESA REFRIGERADAS MARCA THERMO SCIENTIFIC, MODELO LEGEND MICRO 17R CENTRÍFUGAS DE MESA REFRIGERADAS MARCA THERMO SCIENTIFIC, MODELO LEGEND MICRO 17R 2 De laboratorio Dólar 12000 23-09-2021
Sistema de medicion portatil para humedad en suelo con sonda de 20 centímetros,incluye estuche Sistema de medicion portatil para humedad en suelo con sonda de 20 centímetros,incluye estuche 1 De laboratorio Dólar 1711,60 23-09-2021
45.1S - MicroTSG (Thermosalinograph) In PVC flow-through housing. Requires 8-30 VDC input power. Includes RS-232 interface, 2.4 meter data I/O and power input cable (PN 801392), AF24173 Anti-Foulant Devices, spare o-ring and hardware kit, Seasoft software, 1 De laboratorio Dólar 5195 24-09-2021
70410 DEBUBBLER, VORTEX, MSRC VDB-1, 2" DIAMETER 1 De laboratorio Dólar 1475 24-09-2021
90402.1S SBE 45 Power, Navigation and Remote Temperature Interface box with US (Standard) AC power cord, DC input connector, 3 m computer serial cable (RS-232), 2.4 m SBE 45 interface cable and NMEA test cable 1 De laboratorio Dólar 2935 24-09-2021
6(sieis) 002216 B6.129S7-Rag1 <tm1 Mon>/J HOM Homozygous for Rag1 <tm1Mon> 6(seis) 002216 B6.129S7-Rag1 <tm1 Mon>/J HOM Homozygous for Rag1 <tm1Mon> Cepa 1 - ratones C57BL/6 deficientes en gen RAG1 (B6.129S7-Rag1<tm1Mom>/J): son ratones con background C57BL/6 que no poseen ni células T ni células B. 6 Animales Dólar 1079,94 1347,39 24-09-2021
3 (tres) 002216 B6.129S7-Rag1<tm1 Mom>/J HOM Homozygous for Rag1 <tm1Mon> 3 (tres) 002216 B6.129S7-Rag1<tm1 Mom>/J HOM Homozygous for Rag1 <tm1Mon> Cepa 1 - ratones C57BL/6 deficientes en gen RAG1 (B6.129S7-Rag1<tm1Mom>/J): son ratones con background C57BL/6 que no poseen ni células T ni células B. 3 Animales Dólar 534,18 666,47 24-09-2021
6(seis) 003770 B6.129X1-Trpv1<tm1Jul>/J HOM Homozygous for Trpv 1<tm 1 Jul> 6(seis) 003770 B6.129X1-Trpv1<tm1Jul>/J HOM Homozygous for Trpv 1<tm 1 Jul> Cepa 2 - ratones C57BL/6 deficientes en gen TRPV1 (B6.129X1-Trpv1<tm1Jul>/J): son ratones con background C57BL/6 que no poseen el nociceptor polimodal TRPV1, por lo que son insensibles al calor moderado y a la capsaicina. 6 Animales Dólar 1424,28 1777,00 24-09-2021
3 (tres) 003770 B6.129X1-Trpv1<tm Jul>/J HOM Homozygous for Trpv1<tm1Jul> 3 (tres) 003770 B6.129X1-Trpv1<tm Jul>/J HOM Homozygous for Trpv1<tm1Jul> 3 Animales Dólar 712,14 888,50 24-09-2021
1 (uno) MIS0010 INTL-Otra tarifa de preparación de documentación de exportación 1 (uno) MIS0010 INTL-Otra tarifa de preparación de documentación de exportación 1 Animales Dólar 247,00 308,17 24-09-2021
6(seis) 004194 B6.Cg-Tg(TcraTcrb)425Cbn/J HOM Homozygous for Tg(TcraTcrb)425Cbn 6(seis) 004194 B6.Cg-Tg(TcraTcrb)425Cbn/J HOM Homozygous for Tg(TcraTcrb)425Cbn Cepa 3 - ratones C57BL/6 transgénicos para gen OT-II (B6.Cg-Tg(TcraTcrb)425Cbn/J): son ratones con background C57BL/6 que son transgénicos para un receptor T específico para ovalbúmina con restricción de MHC II, por lo que todas sus células T CD4+ lo expresan. 6 Animales Dólar 1554,06 1938,93 24-09-2021
3 (tres) 004194 B6.Cg-Tg(TcraTcrb)425Cbn/J HOM Homozygous for Tg(TcraTcrb)425Cbn 3 (tres) 004194 B6.Cg-Tg(TcraTcrb)425Cbn/J HOM Homozygous for Tg(TcraTcrb)425Cbn Cepa 3 - ratones C57BL/6 transgénicos para gen OT-II (B6.Cg-Tg(TcraTcrb)425Cbn/J): son ratones con background C57BL/6 que son transgénicos para un receptor T específico para ovalbúmina con restricción de MHC II, por lo que todas sus células T CD4+ lo expresan. 3 Animales Dólar 777,03 969,46 24-09-2021
1(uno) MIS0010 INTL- Otra tarifa de preparación de documentación de exportación 1(uno) MIS0010 INTL- Otra tarifa de preparación de documentación de exportación 1 Animales Dólar 247,00 308,17 24-09-2021
6(seis) SMF0001 Contenedor de transporte de producción 6(seis) SMF0001 Contenedor de transporte de producción 6 Animales Dólar 87,00 108,54 24-09-2021
Cánula guía bilateral C235G-2.2/SPC GUIDE DBL 39867 26GA 2.2MM Nro de Parte 8IC235G22XXC CUT 3MM BELOW PEDESTAL 50 De laboratorio Dólar 348,50 24-09-2021
Cánulas internas bilaterales C235I/SPC INTERNAL DBL 38981 33GA Nro de Parte 8IC235ISPCXC FIT 3MM C235G-2.2 W 1MM PROJ 100 De laboratorio Dólar 788,00 24-09-2021
Cánulas “ficticias” bilaterales C235DC/SPC DUMMY DBL .008"/.2MM Nro de Parte 8IC235DCSPCC FIT 3MM C235G-2.2 W/0 PROJ 25 De laboratorio Dólar 186,25 24-09-2021
Tapas 303DC/1 DUST CAP 41908 SMALL ROUND TOP Nro de Parte 8K0000303DC1 20 De laboratorio Dólar 21,40 24-09-2021
Accesorio Óptico VIPA 725-875 nm, 3.371 mm thick (1.0cm-1 FSR) Nro de Parte OP-6721-3371-4 1 De laboratorio Dólar 2.800,00 24-09-2021
AE1 anion exchange membrane of MI's AMI7001made in the USA, HS code: 39219090.01(width:120cm) Membranas de intercambio aniónico 3 De laboratorio Dólar 870 24-09-2021
AE3 anion exchange membrane of LANXESS'sMA7500 made in the USA, HS code: 39219090.01(width:109cm) Membranas de intercambio aniónico 1 De laboratorio Dólar 290 24-09-2021
CE2 cation exchange membrane of LANXESS'sMC3470 made in the USA, HS code: 39219090.01(width:109cm) Membranas de intercambio aniónico 1 De laboratorio Dólar 350 24-09-2021
Objetivo de microscopio de larga distancia focal (10.6MM), de magnificación 50x, y de apertura numérica NA 0.50 marca Oympus modelo LMPLFLN50XBD. Item N2183900 LMPLFLN50XBD;LWD M PLAN FL 50X BD OBJ, NA 0.5, WD 10.6MM 1 De laboratorio Dólar 3.124,00 24-09-2021
PE9655 - SMA Female to 2.4mm Male Adapter Este adaptador de macho SMA a hembra SMA posee una impedancia de 50ohm y un ancho de banda acorde con los requisitos planteados para las mediciones (27GHz). 2 Electrónica Dólar 437,22 478,72 24-09-2021
PE9081 - SMA Female to N Male Adapter Este adaptador de hembra SMA a macho tipo N posee una impedancia de 50 y un ancho de banda de 11GHz, lo cual lo hace acorde a los requisitos planteados para las mediciones. 6 Electrónica Dólar 103,92 113,78 24-09-2021
PE300-36 - SMA Male to SMA Male Cable 36 Inch Length Using PE-P141 Coax with HeatShrink, LF Solder Este cable con terminacion SMA (macho) en ambos extremos y longitud de 36 pulgadas esta ensamblado con conectores de gran ancho de banda, con soldadura en sus extremos y un cable coaxial de 50ohm que dan como resultado un producto apto para ser utilizado en frecuencias de hasta 18GHz. 2 Electrónica Dólar 306,64 335,74 24-09-2021
PE304-36 - SMA Male to N Male Cable 36 Inch Length Using PE-P141 Coax with HeatShrink, LF Solder Este cable con terminacio´n SMA (macho) en un extremo y N (macho) en el otro posee una longitud de 36 pulgadas y un ancho de banda de 18GHz. Esta construido con un cable de alta performance de 50ohm. 2 Electrónica Dólar 395,24 432,75 24-09-2021
PE5019-1A - Fixed Break-Over Torque Wrench With 5/16 Bit For 3.5mm, 2.92mm, 2.4mm, SMA Connectors Pre-set to 8 in-lbs Esta llave torquime´trica es necesaria para realizar el ajuste de los conectores SMA. Un sobre o sub ajuste en este tipo de conectores produce deformaciones en las sen~ales de alta frecuencia que se requiere medir. El torque de esta llave es de 8libras/pulgada 1 Electrónica Dólar 233,35 255,50 24-09-2021
PE2CP000-20 - Directional 20 dB SMA Coupler From 2 GHz to 18 GHz Rated to 50 Watts El acoplador direccional PE2CP000-20 esta´ compuesto por puertos SMA (H) con un rango de 2 GHz a 18GHz de frecuencia u´til. La ma´xima potencia admitida de entrada es de 50Watts. 1 Electrónica Dólar 711,20 778,70 24-09-2021

Contacto

Dirección: Godoy Cruz 2320, 2º piso
Código postal: C1425FQD
Teléfono: (54-11) 4899-5000 int. 2082/2084/2086/2088/2090/2092/2094
Correo electrónico: info_roecyt@mincyt.gob.ar

Redes sociales del área